Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3jv3A_

Fold library idPDB HeaderMoleculeTitle
c3jv3A_PDB header: protein bindingChain: A: PDB Molecule: intersectin-1;PDBTitle: structure of sh3e-dh unit of murine intersectin-1l


Added to library: Wed Jan 9 15:27:57 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQWCSDL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SS
B

SSTTB

B
TT


STTTTGGGGGGS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMCNIKL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTGGGS
TTTT
SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPR
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TT





GGGGT
TTSGG
 .........220.........230.........240.........250.........260.........270........
Sequence CKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRL
Predicted secondary structure











SS confidence



































































Known secondary structure (DSSP) GTT

TTTTS
TTSTTGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D