Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3jclC_

Fold library idPDB HeaderMoleculeTitle
c3jclC_4.00PDB header: viral proteinChain: C: PDB Molecule: spike glycoprotein;


Added to library: Sat Feb 6 08:24:12 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YIGDFRCIQLVNSNGANVSAPSISTETVEVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSKFRNLALRGT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SSB



SS









GGGSTT
B

TT



S
TT



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NSVSLSWFQPPYLNQFNDGIFAKVQNLKTSTPSGATAYFPTIVIGSLFGYTSYTVVIEPYNGVIMASVCQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SGGGSSTTTS
TT
GGGTS
TT



S
SS
STTS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YTICQLPYTDCKPNTNGNKLIGFWHTDVKPPICVLKRNFTLNVNADAFYFHFYQHGGTFYAYYADKPSAT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

BBSS

SS


TT


S
SSB

SS



TT
STTSSSS
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence TFLFSVYIGDILTQYYVLPFICNPTAGSTFAPRYWVTPLVKRQYLFNFNQKGVITSAVDCASSYTSEIKC
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS






TTGGG




TTS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KTQSMLPSTGVYELSGYTVQPVGVVYRRVANLPACNIEEWLTARSVPSPLNWERKTFQNCNFNLSSLLRY
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS


S
















B

T
S



TTS

S
TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VQAESLFCNNIDASKVYGRCFGSISVDKFAVPRSRQVDLQLGNSGFLQTANYKIDTAATSCQLHYTLPKN
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TSS
TT
S

GGGSTT

SS





B

SSS


TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence NVTINNHNPSSWNRRYGFNDAGVFGKNQHDVVYAQQCFTVRSSYCPCAQPDIVSPCTTQTKPKSAFVNVG
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
TTTS


TTSSS
TT

T


BTS

GGGTT

SS
SSTT





TTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence DHCEGLGVLEDNCGNADPHKGCICANNSFIGWSHDTCLVNDRCQIFANILLNGINSGTTCSTDLQLPNTE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) T
TT
SSSS
S

SS
GGG
S

TTSSSSS



TTS
S
TT





 .........570.........580.........590.........600.........610.........620.........630
Sequence VVTGICVKYDLYGITGQGVFKEVKADYYNSWQTLLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAFHK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

BSSTT
GGG
SS

S
TTS
TTTT
S




T
 .........640.........650.........660.........670.........680.........690.........700
Sequence DAPEPALLYRNINCSYVFSNNISREENPLNYFDSYLGCVVNADNRTDEALPNCDLRMGAGLCVDYSKSRR
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) T
SS
T

TT
S
S

TT
TTS
SSS
S
STTSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence AHSSVSTGYRLTTFEPYTPMLVNDSVQSVDGLYEMQIPTNFTIGHHEEFIQTRSPKVTIDCAAFVCGDNT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT



TTSSGGG








S
 .........780.........790.........800.........810.........820.........830.........840
Sequence ACRQQLVEYGSFCVNVNAILNEVNNLLDNMQLQVASALMQGVSAIRGRSAIEDLLFDKVKLSDVGFVEAY
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) GGGTT

T
S
S
 .........850.........860.........870.........880.........890.........900.........910
Sequence NNCTGGQEVRDLLCVQSFNGIKVLPPVLSESQISGYTTGATAAAMFPPWSAAAGVPFSLSVQYRINGLGV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GGGTSSTT
TT

SS
S
T

TTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence TMNVLSENQKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEIL
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)
TTTSS
TTS

GGG

SSS
S
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence TRLEAVEAKAQIDRLINGRLTALNAYISKQLSDSTLIKVSAAQAIEKVNECVKSQTTRINFCGNGNHILS
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTS
TSS



SSSS
TT
SS
 .........1060.......
Sequence LVQNAPYGLYFIHFSYV
Predicted secondary structure






SS confidence
















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D