Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3jclC_

Fold library idPDB HeaderMoleculeTitle
c3jclC_4.00PDB header: viral proteinChain: C: PDB Molecule: spike glycoprotein;


Added to library: Sat Feb 6 08:24:12 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YIGDFRCIQLVNSNGANVSAPSISTETVEVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSKFRNLALRGT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

SSB



SS









GGGSTT
B

TT



S
TT



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NSVSLSWFQPPYLNQFNDGIFAKVQNLKTSTPSGATAYFPTIVIGSLFGYTSYTVVIEPYNGVIMASVCQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SGGGSSTTTS
TT
GGGTS
TT



S
SS
STTS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YTICQLPYTDCKPNTNGNKLIGFWHTDVKPPICVLKRNFTLNVNADAFYFHFYQHGGTFYAYYADKPSAT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

BBSS

SS


TT


S
SSB

SS



TT
STTSSSS
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence TFLFSVYIGDILTQYYVLPFICNPTAGSTFAPRYWVTPLVKRQYLFNFNQKGVITSAVDCASSYTSEIKC
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS






TTGGG




TTS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KTQSMLPSTGVYELSGYTVQPVGVVYRRVANLPACNIEEWLTARSVPSPLNWERKTFQNCNFNLSSLLRY
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TS


S
















B

T
S



TTS

S
TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VQAESLFCNNIDASKVYGRCFGSISVDKFAVPRSRQVDLQLGNSGFLQTANYKIDTAATSCQLHYTLPKN
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TSS
TT
S

GGGSTT

SS





B

SSS


TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence NVTINNHNPSSWNRRYGFNDAGVFGKNQHDVVYAQQCFTVRSSYCPCAQPDIVSPCTTQTKPKSAFVNVG
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
TTTS


TTSSS
TT

T


BTS

GGGTT

SS
SSTT





TTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence DHCEGLGVLEDNCGNADPHKGCICANNSFIGWSHDTCLVNDRCQIFANILLNGINSGTTCSTDLQLPNTE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) T
TT
SSSS
S

SS
GGG
S

TTSSSSS



TTS
S
TT





 .........570.........580.........590.........600.........610.........620.........630
Sequence VVTGICVKYDLYGITGQGVFKEVKADYYNSWQTLLYDVNGNLNGFRDLTTNKTYTIRSCYSGRVSAAFHK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

BSSTT
GGG
SS

S
TTS
TTTT
S




T
 .........640.........650.........660.........670.........680.........690.........700
Sequence DAPEPALLYRNINCSYVFSNNISREENPLNYFDSYLGCVVNADNRTDEALPNCDLRMGAGLCVDYSKSRR
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) T
SS
T

TT
S
S

TT
TTS
SSS
S
STTSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence AHSSVSTGYRLTTFEPYTPMLVNDSVQSVDGLYEMQIPTNFTIGHHEEFIQTRSPKVTIDCAAFVCGDNT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT



TTSSGGG








S
 .........780.........790.........800.........810.........820.........830.........840
Sequence ACRQQLVEYGSFCVNVNAILNEVNNLLDNMQLQVASALMQGVSAIRGRSAIEDLLFDKVKLSDVGFVEAY
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) GGGTT

T
S
S
 .........850.........860.........870.........880.........890.........900.........910
Sequence NNCTGGQEVRDLLCVQSFNGIKVLPPVLSESQISGYTTGATAAAMFPPWSAAAGVPFSLSVQYRINGLGV
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GGGTSSTT
TT

SS
S
T

TTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence TMNVLSENQKMIASAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISASLQEIL
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)
TTTSS
TTS

GGG

SSS
S
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence TRLEAVEAKAQIDRLINGRLTALNAYISKQLSDSTLIKVSAAQAIEKVNECVKSQTTRINFCGNGNHILS
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTS
TSS



SSSS
TT
SS
 .........1060.......
Sequence LVQNAPYGLYFIHFSYV
Predicted secondary structure






SS confidence
















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D