Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3j21Z_

Fold library idPDB HeaderMoleculeTitle
c3j21Z_PDB header: ribosomeChain: Z: PDB Molecule: 50s ribosomal protein l30e;PDBTitle: promiscuous behavior of proteins in archaeal ribosomes revealed by2 cryo-em: implications for evolution of eukaryotic ribosomes (50s3 ribosomal proteins)


Added to library: Wed Jan 9 14:36:31 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDLAFELRKAMETGKVVLGSNETIRLAKTGGAKLIIVAKNAPKEIKDDIYYYAKLSDIPVYEFEGTSVEL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS
ST

S



TT




S
GG
 .........80.........90.........
Sequence GTLLGKPFVVASLAIVDPGESKILAIAKR
Predicted secondary structure









SS confidence




























Known secondary structure (DSSP) GGTT
STT
SSS
SS
ST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D