Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3j21Y_

Fold library idPDB HeaderMoleculeTitle
c3j21Y_PDB header: ribosomeChain: Y: PDB Molecule: 50s ribosomal protein l30p;PDBTitle: promiscuous behavior of proteins in archaeal ribosomes revealed by2 cryo-em: implications for evolution of eukaryotic ribosomes (50s3 ribosomal proteins)


Added to library: Wed Jan 9 18:15:44 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAKLAVIRIRGRVNVKRPVRDTLAMLRLHRVNHCVIVDDTPSYLGMLQKAKDYITWGEINAETLAKLIRK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


S
STT

TT

STT

TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence RGRLIGNKPVTDEYVKEKLGMTIEEFAQKVVNGEMSLKDLPNLKPVFRLHPPRGGFRGSKKRSFKEGGAL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SSSS



SSS
TSS
TTTS
SS
S



TT
SSS
SSSBTTTTSSB
 .........150.....
Sequence GYRGEKINELIERML
Predicted secondary structure



SS confidence














Known secondary structure (DSSP)

TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D