Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3j0xJ_

Fold library idPDB HeaderMoleculeTitle
c3j0xJ_PDB header: ribosomeChain: J: PDB Molecule: 30s ribosomal protein s7;PDBTitle: structural characterization of mrna-trna translocation intermediates2 (30s ribosome of class 4b of the six classes)


Added to library: Thu Jan 10 03:18:44 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SS








BTTB



TT

SS
SST

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S
SSSS


TS

SSTT
STT
 .........150.........160.........170........
Sequence HRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) GGG

TTTS

SS



SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D