Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3j0xJ_

Fold library idPDB HeaderMoleculeTitle
c3j0xJ_PDB header: ribosomeChain: J: PDB Molecule: 30s ribosomal protein s7;PDBTitle: structural characterization of mrna-trna translocation intermediates2 (30s ribosome of class 4b of the six classes)


Added to library: Thu Jan 10 03:18:44 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SS








BTTB



TT

SS
SST

 .........80.........90.........100.........110.........120.........130.........140
Sequence TVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S
SSSS


TS

SSTT
STT
 .........150.........160.........170........
Sequence HRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) GGG

TTTS

SS



SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D