Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3j0aA_

Fold library idPDB HeaderMoleculeTitle
c3j0aA_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 5;PDBTitle: homology model of human toll-like receptor 5 fitted into an electron2 microscopy single particle reconstruction


Added to library: Thu Jan 10 08:14:51 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRTVTASSFPFLEQLQLLELGSQYTPLTIDKEAFR
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

BTTTS


SS


SS
TT

S




SSS
SS

S
S
TT




TTTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) S
TT


TT




TTSS
S
SS



TT


SS

STT


SS
SS

S







 .........150.........160.........170.........180.........190.........200.........210
Sequence HPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILD
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
GGGGT
SS

SS





SGGG
SS




SBS








SSS
TTTT

BSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence VSGNGWTVDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFVFS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SS

SSTTTTSGGGGTS
S

BS

SS

B
SSS
SSSTTGGGTTTTTTTTS



TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence LNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKNHI
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S

SSS




S




TTTTTT
SS

S


S


S
S
SS
TT



S


 .........360.........370.........380.........390.........400.........410.........420
Sequence AIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILY
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)



SS
S
S




T

S


SS

S
SS









TT



S



SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLGENMLQLAWETELCWDVFEGLSHLQVLYLNHN
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) TT
TT

S






SSSSS
S
TT

B
S


SSS

S


SS
SS
B






 .........500.........510.........520.........530.........540.........550.........560
Sequence YLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TT

TTSSSS

S
SS


SS






S








S


SS




 .........570.........580.........590.........600.........610.........620.........630
Sequence CECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCFSLFIVCTVTLTLFLMTILTVTK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS

STTTTT


GGG


SS
SSS
S

TTT






TTTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence FRDHPQGTEPDMYKYDAYLCFSSKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRIANIQDAI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



GGGSSS



S

STTTSTTTTTT
S

SSSS

SSS
 .........710.........720.........730.........740.........750.........760.........770
Sequence WNSRKIVCLVSRHFLRDGWCLEAFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS
TTTSTTS



SS
TTSS


SSS

S
SSTTTT




 .........780.........790.......
Sequence PEDFQDVGWFLHKLSQQILKKEKEKKK
Predicted secondary structure
















SS confidence


























Known secondary structure (DSSP)
SSSTTTTTTTTTS



S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D