Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ip4B_

Fold library idPDB HeaderMoleculeTitle
c3ip4B_PDB header: ligaseChain: B: PDB Molecule: aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b;PDBTitle: the high resolution structure of gatcab


Added to library: Wed Jan 9 22:32:39 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)




SB
SSSSSBSS

SSTT
S

TTTTT
TT





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S



BTTBTTS
SSS
S
SSSS



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTTT

S
B
STS



GGGTSTTS




 .........220.........230.........240.........250.........260.........270.........280
Sequence LKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


ST




TTTS

S






TTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence DDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TT



TS


TSSTTT

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence YLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT

GGGSS

TSS



TTT


B

 .........430.........440.........450.........460.........470.........480..
Sequence FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Predicted secondary structure












SS confidence





























































Known secondary structure (DSSP)
TT
S
TTS
B
T







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D