Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3ip4B_

Fold library idPDB HeaderMoleculeTitle
c3ip4B_PDB header: ligaseChain: B: PDB Molecule: aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b;PDBTitle: the high resolution structure of gatcab


Added to library: Wed Jan 9 22:32:39 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)




SB
SSSSSBSS

SSTT
S

TTTTT
TT





TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S



BTTBTTS
SSS
S
SSSS



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTTT

S
B
STS



GGGTSTTS




 .........220.........230.........240.........250.........260.........270.........280
Sequence LKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


ST




TTTS

S






TTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence DDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TT



TS


TSSTTT

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence YLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT

GGGSS

TSS



TTT


B

 .........430.........440.........450.........460.........470.........480..
Sequence FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Predicted secondary structure












SS confidence





























































Known secondary structure (DSSP)
TT
S
TTS
B
T







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D