Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3gp8A_

Fold library idPDB HeaderMoleculeTitle
c3gp8A_PDB header: hydrolase/dnaChain: A: PDB Molecule: exodeoxyribonuclease v, subunit recd, putative;PDBTitle: crystal structure of the binary complex of recd2 with dna


Added to library: Wed Jan 9 14:56:17 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QGLERRLLAGLQGLGLTINQAQRAVKHFGADALDRLEKDLFTLTEVEGIGFLTADKLWQARGGALDDPRR
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



TT


TT
GGGGGGSTTS
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTAAAVYALQLAGTQAGHSFLPRSRAEKGVVHYTRVTPGQARLAVETAVELGRLSEDDSPLFAEAAATGE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S



TTSS






TTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRIYLPHVLRAEKKLASLIRTLLATPPADDDWAVPKKARKGLSEEQASVLDQLAGHRLVVLTGGPGTGKS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

S









GGGGTT


S
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TTTKAVADLAESLGLEVGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPQGFRHNHLEPAPYDLLIVDEV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

SSTS
TTTTS
SSSS

S
S

G
 .........290.........300.........310.........320.........330.........340.........350
Sequence SMMGDALMLSLLAAVPPGARVLLVGDTDQLPPVDAGLPLLALAQAAPTIKLTQVYRQAAKNPIIQAAHGL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GG

TS
TT

TTS


SSS

S




S
 .........360.........370.........380.........390.........400.........410.........420
Sequence LHGEAPAWGDKRLNLTEIEPDGGARRVALMVRELGGPGAVQVLTPMRKGPLGMDHLNYHLQALFNPGEGG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT





SSS

STTT
TTT
S
SSSTTS


S

 .........430.........440.........450.........460.........470.........480.........490
Sequence VRIAEGEARPGDTVVQTKNIFNGTLGMVLKAEGARLTVDNVVELTGAELFNLQLGYALTVHRAQGSEWGT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS
TT






TT
B

TT


B


TTGGGG
STT

 .........500.........510.........520.........530.........540.........550.
Sequence VLGVLHEAHMPMLSRNLVYTALTRARDRFFSAGSASAWQIAAARQREARNTALLERIRAHL
Predicted secondary structure






















SS confidence




























































Known secondary structure (DSSP)
GGGGGG

T











Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D