Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3gp8A_

Fold library idPDB HeaderMoleculeTitle
c3gp8A_PDB header: hydrolase/dnaChain: A: PDB Molecule: exodeoxyribonuclease v, subunit recd, putative;PDBTitle: crystal structure of the binary complex of recd2 with dna


Added to library: Wed Jan 9 14:56:17 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QGLERRLLAGLQGLGLTINQAQRAVKHFGADALDRLEKDLFTLTEVEGIGFLTADKLWQARGGALDDPRR
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



TT


TT
GGGGGGSTTS
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTAAAVYALQLAGTQAGHSFLPRSRAEKGVVHYTRVTPGQARLAVETAVELGRLSEDDSPLFAEAAATGE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S



TTSS






TTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRIYLPHVLRAEKKLASLIRTLLATPPADDDWAVPKKARKGLSEEQASVLDQLAGHRLVVLTGGPGTGKS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

S









GGGGTT


S
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TTTKAVADLAESLGLEVGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPQGFRHNHLEPAPYDLLIVDEV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

SSTS
TTTTS
SSSS

S
S

G
 .........290.........300.........310.........320.........330.........340.........350
Sequence SMMGDALMLSLLAAVPPGARVLLVGDTDQLPPVDAGLPLLALAQAAPTIKLTQVYRQAAKNPIIQAAHGL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GG

TS
TT

TTS


SSS

S




S
 .........360.........370.........380.........390.........400.........410.........420
Sequence LHGEAPAWGDKRLNLTEIEPDGGARRVALMVRELGGPGAVQVLTPMRKGPLGMDHLNYHLQALFNPGEGG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT





SSS

STTT
TTT
S
SSSTTS


S

 .........430.........440.........450.........460.........470.........480.........490
Sequence VRIAEGEARPGDTVVQTKNIFNGTLGMVLKAEGARLTVDNVVELTGAELFNLQLGYALTVHRAQGSEWGT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS
TT






TT
B

TT


B


TTGGGG
STT

 .........500.........510.........520.........530.........540.........550.
Sequence VLGVLHEAHMPMLSRNLVYTALTRARDRFFSAGSASAWQIAAARQREARNTALLERIRAHL
Predicted secondary structure






















SS confidence




























































Known secondary structure (DSSP)
GGGGGG

T











Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D