Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3gozA_

Fold library idPDB HeaderMoleculeTitle
c3gozA_PDB header: structural genomics, unknown functionChain: A: PDB Molecule: leucine-rich repeat-containing protein;PDBTitle: crystal structure of the leucine-rich repeat-containing2 protein legl7 from legionella pneumophila. northeast3 structural genomics consortium target lgr148


Added to library: Sat Aug 28 23:23:39 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XNYKLTLHPGSNPVEEFTSIPHGVTSLDLSLNNLYSISTVELIQAFANTPASVTSLNLSGNSLGFKNSDE
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)




TT

TS
TT


TTS
GGGS
T

TT



SS
GGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVQILAAIPANVTSLNLSGNFLSYKSSDELVKTLAAIPFTITVLDLGWNDFSSKSSSEFKQAFSNLPASI
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TS
TT



SS
GGGS
TS
TT



SS
GGGS
TTS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TSLNLRGNDLGIKSSDELIQILAAIPANVNSLNLRGNNLASKNCAELAKFLASIPASVTSLDLSANLLGL
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)

TTS
GGGS
TS
TT


TTS
GGGS
TS
TT


TTS
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence KSYAELAYIFSSIPNHVVSLNLCLNCLHGPSLENLKLLKDSLKHLQTVYLDYDIVKNXSKEQCKALGAAF
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S
S
TT



SS





TTTTTTT
STT

TTS
 .........290.........300.........310.........320
Sequence PNIQKIILVDKNGKEIHPSHSIPISNLIRELSGKADVPSL
Predicted secondary structure





















SS confidence







































Known secondary structure (DSSP) TT


TTS
B

GGG
T


TTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D