Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3g5bA_

Fold library idPDB HeaderMoleculeTitle
c3g5bA_PDB header: apoptosisChain: A: PDB Molecule: netrin receptor unc5b;PDBTitle: the structure of unc5b cytoplasmic domain


Added to library: Sun Aug 29 02:42:16 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PGSSVSGTFGCLGGRLTIPGTGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLSEGSQTVLSPSVTCGPT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT
TT
TTTT
TTSS
TT



GGGGGGG
STT
S


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLLLCRPVVLTVPHCAEVIAGDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEAKSCHILLDQLGTY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S


SS


B

SSS

SSTT
TT


TT
S
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VFTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDTPAALKEVLELERTLGGYLVEEPKPLLFKDS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TT
S


SSSST
S

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence YHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQKALHCTFTLERHSLASTEFTCKVCVRQVEGEGQ
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S




TTT

SSS

S


TT
SSTT

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IFQLHTTLTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TTTT
SS
SS

TTSTTTT

TTTTSS
 .........360.........370.........380...
Sequence WEARQQDDGDLNSLASALEEMGKSEMLVAMTTD
Predicted secondary structure











SS confidence
































Known secondary structure (DSSP) TTT

TT




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D