Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3g06A_

Fold library idPDB HeaderMoleculeTitle
c3g06A_PDB header: ligaseChain: A: PDB Molecule: ssph2 (leucine-rich repeat protein);PDBTitle: the salmonella virulence effector ssph2 functions as a2 novel e3 ligase


Added to library: Sat Aug 28 16:46:55 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVWSAWRRAAPAEESRGRAAVVQKMRACLNNGNAVLNVGESGLTTLPDCLPAHITTLVIPDNNLTSLPAL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
T

GGG




SS

S


S


TT
S
S


S




 .........80.........90.........100.........110.........120.........130.........140
Sequence PPELRTLEVSGNQLTSLPVLPPGLLELSIFSNPLTHLPALPSGLCKLWIFGNQLTSLPVLPPGLQELSVS
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
TT


S


S





TT


S









TT



SS

S





TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence DNQLASLPALPSELCKLWAYNNQLTSLPMLPSGLQELSVSDNQLASLPTLPSELYKLWAYNNRLTSLPAL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) SS

S





TT



SS

S





TT



SS

S





TT



SS

SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence PSGLKELIVSGNRLTSLPVLPSELKELMVSGNRLTSLPMLPSGLLSLSVYRNQLTRLPESLIHLSSETTV
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP)
TT



SS

S





TT



SS

S





TT



SS


S

GGGGGS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NLEGNPLSERTLQALREITSAPGYSGPIIRFDMAGAETRALHLAAADWLVPADRWHMFGQEDNADAFSLF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S



STT

S


S






TT



TTSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LDRLSETENFIKDAGFKAQISSWLAQLAEDEALRANTFAMATEATSSCEDRVTFFLHQMKNVQLVHNAEK
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS
TTT
TTTTTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GQYDNDLAALVATGREMFRLGKLEQIAREKVRTLALVDEIEVWLAYQNKLKKSLGLTSVTSEMRFFDVSG
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTTT
T
S
TTTTTT
TTS
S

S
GGGS
 .........500.........510.........520.........530.........540.........550.........560
Sequence VTVTDLQDAELQVKAAEKSEFREWILQWGPLHRVLERKAPERVNALREKQISDYEETYRMLSDTELRPSG
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

T
STTTTSS
 .........570.........580.........590.........600.
Sequence LVGNTDAERTIGARAMESAKKTFLDGLRPLVEEMLGSYLNV
Predicted secondary structure





SS confidence








































Known secondary structure (DSSP)
SS
GGGS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D