Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3g04C_

Fold library idPDB HeaderMoleculeTitle
c3g04C_PDB header: immune systemChain: C: PDB Molecule: thyrotropin receptor;PDBTitle: crystal structure of the tsh receptor in complex with a2 thyroid-stimulating autoantibody


Added to library: Sat Aug 28 17:57:28 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYN
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TTT
S
SS




TT
SS


S
TTTTTT
TT



SS


TTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

TT


TTS

TT



SS



TT

B

SS
TT


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence NAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVT
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTTTTTBSS

S


S
TTTTTT
B
TT
TT


TTTTTT
SB

S
TTS


 .........220........
Sequence ALPSKGLEHLKELIARNT
Predicted secondary structure









SS confidence

















Known secondary structure (DSSP)


STT
SS
S




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D