Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3fxiA_

Fold library idPDB HeaderMoleculeTitle
c3fxiA_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 4;PDBTitle: crystal structure of the human tlr4-human md-2-e.coli lps2 ra complex


Added to library: Tue Mar 16 13:42:30 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDG
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

STTT

SS

SS


SS
SS



S




B
TT


S
TT


TT




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFK
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) SSTT
SS


TT




TTTTTT
TT


TTS



STT
TTTT
TT



SS





 .........150.........160.........170.........180.........190.........200.........210
Sequence LPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

GGGTT
TT



SS



GGGGTTGGG
SS



TT




TTTTTT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNC
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SSTTT


TTS


S


TTTTGGGGGSSS



STTTSGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLE
Predicted secondary structure




































































SS confidence





































































Known secondary structure (DSSP) GSS
SB
TT









SS
B
SS





SS

S
BS
SB





TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence FLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSL
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP)

SS

BT
S




S
ST
TT


TTSSTBTTBTTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence RNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAF
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TT


TTS


B

TTTTTT
SS



B
TT

BGGG


S

TT

S



B
TTS


S

TTSG
 .........500.........510.........520.........530.........540.........550.........560
Sequence NSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) GG
SS



B
TTS

SS


SGGGG
TT






SS




S


TT


TT






S




SGG
 .........570.........580.........590.........600.
Sequence HQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITC
Predicted secondary structure


















SS confidence








































Known secondary structure (DSSP) GTTTT


GGG
B

S
SSS
SSBTTS





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D