Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3fm8A_

Fold library idPDB HeaderMoleculeTitle
c3fm8A_PDB header: transport protein/hydrolase activatorChain: A: PDB Molecule: kinesin-like protein kif13b;PDBTitle: crystal structure of full length centaurin alpha-1 bound2 with the fha domain of kif13b (capri target)


Added to library: Sat Aug 28 21:42:28 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT

TTSS




SSSTT
S

STT

SS

TTS

TT

TT
 .........80.........90........
Sequence SSVSSPIQLHHGDRILWGNNHFFRLNLP
Predicted secondary structure










SS confidence



























Known secondary structure (DSSP)

S

TT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D