Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3eopB_

Fold library idPDB HeaderMoleculeTitle
c3eopB_PDB header:Chain: B: PDB Molecule: thymocyte nuclear protein 1;PDBTitle: crystal structure of the duf55 domain of human thymocyte2 nuclear protein 1


Added to library: Sat Aug 28 23:34:37 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHWLMKSEPDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)








SGGG







TT


SSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQR
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

GGGG
TTSTT

TT

TTS
S

S

TTTT

TT
 .........150.........160.
Sequence LSIQPLTQEEFDFVLSLEELE
Predicted secondary structure






SS confidence




















Known secondary structure (DSSP)
S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D