Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3eolB_

Fold library idPDB HeaderMoleculeTitle
c3eolB_PDB header: lyaseChain: B: PDB Molecule: isocitrate lyase;PDBTitle: 2.0a crystal structure of isocitrate lyase from brucella melitensis2 (p43212)


Added to library: Wed Jan 9 19:35:17 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVNALGALSGNQAMQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TTTSTT

TTTTTT


SS
TS
SS



SS
B
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVRAGLKAIYLSAGPELAKRINRTLQRADQIETAEGKGLSVDTWFAPIVADAEGDPLDAFEIMKAYIEAG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




TT



SS
S






T
 .........150.........160.........170.........180.........190.........200.........210
Sequence AAGVHFEDQLAGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SSB






T



TTT

S


STTTGGGB
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence GRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKAHPGKLLAYNCSPSFNWK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTS
B

SGGG
S

SS

STT



SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQQAEFAAEADGYTAT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S
TTTTGGGT

S
 .........360..
Sequence KGYFDAVSLAIT
Predicted secondary structure


SS confidence











Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D