Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3eolB_

Fold library idPDB HeaderMoleculeTitle
c3eolB_PDB header: lyaseChain: B: PDB Molecule: isocitrate lyase;PDBTitle: 2.0a crystal structure of isocitrate lyase from brucella melitensis2 (p43212)


Added to library: Wed Jan 9 19:35:17 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DFYSLIPSAPKGRFDGIERAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVNALGALSGNQAMQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TTTSTT

TTTTTT


SS
TS
SS



SS
B
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVRAGLKAIYLSAGPELAKRINRTLQRADQIETAEGKGLSVDTWFAPIVADAEGDPLDAFEIMKAYIEAG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




TT



SS
S






T
 .........150.........160.........170.........180.........190.........200.........210
Sequence AAGVHFEDQLAGGKVLIPTAAHIRNLNAARLAADVMGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SSB






T



TTT

S


STTTGGGB
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence GRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLAQARRFAEAVHKAHPGKLLAYNCSPSFNWK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTS
B

SGGG
S

SS

STT



SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQQAEFAAEADGYTAT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S
TTTTGGGT

S
 .........360..
Sequence KGYFDAVSLAIT
Predicted secondary structure


SS confidence











Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D