Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3e6jA_

Fold library idPDB HeaderMoleculeTitle
c3e6jA_PDB header: immune systemChain: A: PDB Molecule: variable lymphocyte receptor diversity region;PDBTitle: crystal structure of variable lymphocyte receptor (vlr)2 rbc36 in complex with h-trisaccharide


Added to library: Tue Mar 16 12:31:33 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AACPSQCSCSGTTVDCRSKRHASVPAGIPTNAQILYLHDNQITKLEPGVFDSLINLKELYLGSNQLGALP
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)



TT
TT
TTS

SS

S


TT
S

SS





TTTTTT
TT



SS





 .........80.........90.........100.........110.........120.........130.........140
Sequence VGVFDSLTQLTVLDLGTNQLTVLPSAVFDRLVHLKELFMCCNKLTELPRGIERLTHLTHLALDQNQLKSI
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT



SS





TTTTTT
TT



SS


S

TTGGG
TT
S

SS




 .........150.........160.........170.........180.........190.........200.........210
Sequence PHGAFDRLSSLTHAYLFGNPWDCECRDIMYLRNWVADHTSIAMRWDGKAVNDPDSAKCAGTNTPVRAVTE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT


TTS
B
TTBGGG
GGGSSS
TT
SBBTTT

BGGG

G
 .........
Sequence ASTSPSKCP
Predicted secondary structure








SS confidence








Known secondary structure (DSSP) GG
BTTS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D