Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3dkbA_

Fold library idPDB HeaderMoleculeTitle
c3dkbA_PDB header: hydrolaseChain: A: PDB Molecule: tumor necrosis factor, alpha-induced protein 3;PDBTitle: crystal structure of a20, 2.5 angstrom


Added to library: Tue Mar 16 14:29:49 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRN
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




SSGGGGGT

SSSS

SSGGG



B


TTS
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence IQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRW
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSSS

SSB

B



SS
SS
STT
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence QLESLKSQEFVEYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


SS



SS
SSTSS


SSSSS
SS



TTS




T
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLESGPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T










TTS
TTSS
SS

SS
B
SSSS
BSS
SSS

BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TS

SSSS







GGG
TGG
 ..
Sequence EQ
Predicted secondary structure

SS confidence

Known secondary structure (DSSP) G


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D