Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3dh3C_

Fold library idPDB HeaderMoleculeTitle
c3dh3C_PDB header: isomerase/rnaChain: C: PDB Molecule: ribosomal large subunit pseudouridine synthase f;PDBTitle: crystal structure of rluf in complex with a 22 nucleotide2 rna substrate


Added to library: Sat Aug 28 18:56:01 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALN
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


TTTSS
TT
TT

TT

TT

TT



GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence KPVGIVSTTEDGERDNIVDFVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT
B



SS
TTBT
SS

SS


TT
S
T
GGG


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PITEEFIRGMSAGVPILGTVTKKCKVKKEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


T

B
SSSB




SSSS


TTTT

TT
 .........220.........230.........
Sequence SGIPLGEWRDLTDDELIDLFKLIENSSSE
Predicted secondary structure











SS confidence




























Known secondary structure (DSSP) TT

TT


T



S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D