Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3cvrA_

Fold library idPDB HeaderMoleculeTitle
c3cvrA_PDB header: ligaseChain: A: PDB Molecule: invasion plasmid antigen;PDBTitle: crystal structure of the full length ipah3


Added to library: Tue Mar 16 13:10:07 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TYADYFSAWDKWEKQALPGENRNEAVSLLKECLINQFSELQLNRLNLSSLPDNLPPQITVLEITQNALIS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT

TT

TT
S

SS

S


S


TT
S

SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LPELPASLEYLDACDNRLSTLPELPASLKHLDVDNNQLTXLPELPALLEYINADNNQLTXLPELPTSLEV
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)




TT



SS

S





TT



SS

S





TT



SS

S





TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence LSVRNNQLTFLPELPESLEALDVSTNLLESLPAVPTEIFFRCRENRITHIPENILSLDPTCTIILEDNPL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

SS

S





TT



SS

SS








SS





GGGGGS
TT

SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SSRIRESLSQQTAQPDPRIYFSXPLADAVTAWFPDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
S







STT


TTTTSTTTTTT
TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence FREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGR
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
T
SS
TT
TTT

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EXFRLEILEDIARDKVRTLHFVDEIEVYLAFQTXLAEKLQLSTAVKEXRFYGVSGVTANDLRTAEAXVRS
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SS
SSS
TTTTT
TT



SSS


TT

 .........430.........440.........450.........460.........470.......
Sequence REENEFTDWFSLWGPWHAVLKRTEADRWALAEEQKYXRETEQQIYRQLTDEVLALRL
Predicted secondary structure





SS confidence
























































Known secondary structure (DSSP) T
T







Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D