Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3bdrA_

Fold library idPDB HeaderMoleculeTitle
c3bdrA_PDB header: structural genomics, unknown functionChain: A: PDB Molecule: ycf58 protein;PDBTitle: crystal structure of fatty acid-binding protein-like ycf582 from thermosynecoccus elongatus. northeast structural3 genomics consortium target ter13.


Added to library: Tue Mar 16 14:27:48 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GXDIRDFFAQSAGRWFSQRTSHHLAFKQTESGKSQLTIELLSVDDPAVIALCQQYDXDPAWAVCGARVSW
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



TTTT
TTSTT

TTTB

 .........80.........90.........100.........110.........120.........130.........140
Sequence DGTHEGSTVLVPIXDQGSRXEGKLLREGRFSXGSDGALTLITEYETIYSEERLWFASPNLRLRTSILKRF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



TT
SS


TTS

SS
TTT
 .........150......
Sequence GGFSXASFCSEIRLGV
Predicted secondary structure



SS confidence















Known secondary structure (DSSP) T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D