Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3b9jI_

Fold library idPDB HeaderMoleculeTitle
c3b9jI_PDB header: oxidoreductaseChain: I: PDB Molecule: xanthine oxidase;PDBTitle: structure of xanthine oxidase with 2-hydroxy-6-methylpurine


Added to library: Tue Mar 16 13:10:39 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


TTTT

TT
BTS

TTS

S
SSSSS
TTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
BGGG
TT

GGGT

TTS


TT

SS
TT
SS

 .........150.........160..
Sequence FQGNLCRCTGYRPILQGFRTFA
Predicted secondary structure










SS confidence





















Known secondary structure (DSSP) TTT


SSS
STT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D