Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3a79B_

Fold library idPDB HeaderMoleculeTitle
c3a79B_PDB header: immune systemChain: B: PDB Molecule: toll-like receptor 6, variable lymphocytePDBTitle: crystal structure of tlr2-tlr6-pam2csk4 complex


Added to library: Sun Aug 29 00:52:26 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ESMVDYSNRNLTHVPKDLPPRTKALSLSQNSISELRMPDISFLSELRVLRLSHNRIRSLDFHVFLFNQDL
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


TTS


S

TTS
TT



SS





GGGTTT
TT



S




TTTTTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence EYLDVSHNRLQNISCCPMASLRHLDLSFNDFDVLPVCKEFGNLTKLTFLGLSAAKFRQLDLLPVAHLHLS
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)

TTS



S


TT
S

SS

SB



GGGGG
TT


SB

TTTTGGGTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence CILLDLVSYHIKGGETESLQIPNTTVLHLVFHPNSLFSVQVNMSVNALGHLQLSNIKLNDENCQRLMTFL
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP) SS



SSS




SSS





SS

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SELTRGPTLLNVTLQHIETTWKCSVKLFQFFWPRPVEYLNIYNLTITERIDREEFTYSETALKSLMIEHV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S
SS

TTSS
S









S
S

 .........290.........300.........310.........320.........330.........340.........350
Sequence KNQVFLFSKEALYSVFAEMNIKMLSISDTPFIHMVCPPSPSSFTFLNFTQNVFTDSVFQGCSTLKRLQTL
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)


SS
T


SSS







SS






SS


TTTTTT

S
SS

 .........360.........370.........380.........390.........400.........410.........420
Sequence ILQRNGLKNFFKVALMTKNMSSLETLDVSLNSLNSHAYDRTCAWAESILVLNLSSNMLTGSVFRCLPPKV
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)

SS


BTTTTTT
TT


TTS

BS

SS





TT



SS


GGGGSS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence KVLDLHNNRIMSIPKDVTHLQALQELNVASNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEW
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) S

SS





TTTTSS


S

SS





TTSTTT
TT




S

B


 .........500.........510.........520.....
Sequence INKHSGVVRNSAGSVAPDSAKCSGSGKPVRSIICP
Predicted secondary structure




























SS confidence


































Known secondary structure (DSSP) TTTT
SSSSB
SSSS
BSSS


TTT




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D