Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3a79A_

Fold library idPDB HeaderMoleculeTitle
c3a79A_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 2, variable lymphocytePDBTitle: crystal structure of tlr2-tlr6-pam2csk4 complex


Added to library: Sat Aug 28 17:04:22 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ESLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINTIEGDA
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)





SSS

SS

SSS
S


TT
S

SS



SSTTSS
TT
S
TTS



TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FYSLGSLEHLDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFSEI
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTT
TT



SS


S

TTSSTT
TT


TT


SSS
SS
SSTT
TT

SSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence RRIDFAGLTSLNELEIKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILSSVRYLELRDTNLA
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)
SSTTTT

TT


TTTTTS


SBGGGTTTTBSS
B
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence RFQFSPLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSEVEFDDCTLNGLGDFNPSESDVVSE
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T





S








SS
GGGGGT
TT


S
S
S




T
 .........290.........300.........310.........320.........330.........340.........350
Sequence LGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEE
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) TTT

S
B
TTGGG



GGGTTTTSS

SS






TT


TTS


 .........360.........370.........380.........390.........400.........410.........420
Sequence YLKNSACKGAWPSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDISRNTFHPMPDSCQWPEKMRFLNLSS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
TTS
TT


TTS



GGG
TT



S






S




TT


TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence TGIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDASLFPVLLVMKIASNQLKSVP
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)






TTS
TT
S

SS

S





TT



SS

SS


TTS
TT



SS

S


 .........500.........510.........520.........530.........540.........550
Sequence DGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Predicted secondary structure

































SS confidence



























































Known secondary structure (DSSP) SS
TTS
TT



S





TTT
TTTS

S

B
TTT

BTTS




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D