Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c3a58A_

Fold library idPDB HeaderMoleculeTitle
c3a58A_PDB header: protein transport/exocytosisChain: A: PDB Molecule: exocyst complex component sec3;PDBTitle: crystal structure of sec3p - rho1p complex from2 saccharomyces cerevisiae


Added to library: Sat Aug 28 19:29:08 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NFLAEQYERDRKAIINCCFSRPDHKTGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SSS

SSSS



SSSTTS


TT

GGG
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTXSKKYYWETNSAKERTVFIKSLIT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
TT

GGG
GGG


SS
TTSSSSS
 .........150.........160.........170.........180.....
Sequence LYIQTFEGHVPELVNWDLSLFYLDERSYQRAVITNRPGSVSPIKS
Predicted secondary structure



























SS confidence












































Known secondary structure (DSSP) TTT
B
S

GGGGT

BTTSSTTSS





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D