Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2zy4F_

Fold library idPDB HeaderMoleculeTitle
c2zy4F_PDB header: lyaseChain: F: PDB Molecule: l-aspartate beta-decarboxylase;PDBTitle: dodecameric l-aspartate beta-decarboxylase


Added to library: Wed Jan 9 18:40:34 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QSLAKLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTS
S

S




S



TT

S

SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence GLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



STTTTTSTS


T
S

SSTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT
TTS
GGGSTTSS
TT
S

GGGSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T


BGGGTSB

GGGG
TTSS
TTT
B


T
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTGGGSSS


SGGGSTTTTT
GGG

SS
TS
SG
 .........360.........370.........380.........390.........400.........410.........420
Sequence SLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYR
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) GG
S
GGG

TTTTTGGG
SS

TT
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTS




TTB

S


S




SS
SSS
 .........500.........510.........520.........530.....
Sequence GRASLANLNEYEYAAIGRALRKMADELYAEYSGQAQNLKLAAALE
Predicted secondary structure










SS confidence












































Known secondary structure (DSSP) SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D