Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2zy4F_

Fold library idPDB HeaderMoleculeTitle
c2zy4F_PDB header: lyaseChain: F: PDB Molecule: l-aspartate beta-decarboxylase;PDBTitle: dodecameric l-aspartate beta-decarboxylase


Added to library: Wed Jan 9 18:40:34 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QSLAKLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTS
S

S




S



TT

S

SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence GLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



STTTTTSTS


T
S

SSTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT
TTS
GGGSTTSS
TT
S

GGGSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T


BGGGTSB

GGGG
TTSS
TTT
B


T
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TTGGGSSS


SGGGSTTTTT
GGG

SS
TS
SG
 .........360.........370.........380.........390.........400.........410.........420
Sequence SLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYR
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) GG
S
GGG

TTTTTGGG
SS

TT
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTS




TTB

S


S




SS
SSS
 .........500.........510.........520.........530.....
Sequence GRASLANLNEYEYAAIGRALRKMADELYAEYSGQAQNLKLAAALE
Predicted secondary structure










SS confidence












































Known secondary structure (DSSP) SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D