Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2z8tX_

Fold library idPDB HeaderMoleculeTitle
c2z8tX_PDB header: hydrolaseChain: X: PDB Molecule: protein-glutaminase;PDBTitle: crystal structure of protein-glutaminase of c.proteolyticum2 strain 9670


Added to library: Tue Mar 16 12:54:11 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LASVIPDVATLNSLFNQIKNQSCGTSTASSPCITFRYPVDGCYARAHKMRQILMNNGYDCEKQFVYGNLK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
BSS
TTBTT
SS

SS
B
TT
TTS
TTB

 .........80.........90.........100.........110.........120.........130.........140
Sequence ASTGTCCVAWSYHVAILVSYKNASGVTEKRIIDPSLFSSGPVTDTAWRNACVNTSCGSASVSSYANTAGN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
SS

TTS

TTT
SSS
B
TB
GGGS

TT
 .........150.........160.........170.........180.....
Sequence VYYRSPSNSYLYDNNLINTNCVLTKFSLLSGCSPSPAPDVSSCGF
Predicted secondary structure




























SS confidence












































Known secondary structure (DSSP)
TT


TTSTTT
BTTBSSS



TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D