Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2z7xB_

Fold library idPDB HeaderMoleculeTitle
c2z7xB_PDB header: immune systemChain: B: PDB Molecule: toll-like receptor 1, variable lymphocytePDBTitle: crystal structure of the tlr1-tlr2 heterodimer induced by2 binding of a tri-acylated lipopeptide


Added to library: Tue Mar 16 13:43:50 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQE
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)



TTS

SS


S

TT
S

SS





TT
TT



SS


GGGGTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNI
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)



SS









S

SS

SS



GGGGG
TT

SS

GGGGGGGTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTTTSS

TTTTTT



SSS









TT
S



STTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSI
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GGGG
TT

TSS
SS









S



 .........290.........300.........310.........320.........330.........340.........350
Sequence HQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTEL
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)



S
TT


SSS







SS






SS


TTTTTT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence ETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLP
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)


SS


BTT
TT



SS

B

GGG
S



TT



SS


GGGGGS

 .........430.........440.........450.........460.........470.........480.........490
Sequence PRIKVLDLHSNKIKSIPKQVVKLEALQELNVASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYL
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TT



SS





GGGGG
TT



SS





TTTTTT
TT



SS
B


 .........500.........510.........520
Sequence SRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Predicted secondary structure
















SS confidence





























Known secondary structure (DSSP) TTTTS

BBTTT

BGGG




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D