Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2z64A_

Fold library idPDB HeaderMoleculeTitle
c2z64A_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 4;PDBTitle: crystal structure of mouse tlr4 and mouse md-2 complex


Added to library: Tue Mar 16 13:06:02 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKA
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

TTT
SSS

SS

SSS
SS



SS



TTTTSS
TT


SS




TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence WHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKL
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTT
TT


TT






TTTTTT
TT


TTS



TTT


TT
TT



SS






 .........150.........160.........170.........180.........190.........200.........210
Sequence PAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNF
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)
GGGGT
TT


TTS



TTTTTTTTT
TT



TT




TTTTTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence NSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLA
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) SST
S

TTSS

S


GGGGTTTTTS


SS

TTGGG
GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
SS









TT


SS


SS





TT

SBSS

B





TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence DLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEK
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)

SBS
B
SS
S




S
S
S

TT
TT


TTSSTTTS
TTTT
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence LLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDT
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)


TTS



S
TTTT
TT


TT
GGG
STTSS
TT
S
TT




TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQK
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT



SS


GGGTTT
TT



SS


S
GGGS
TT



S

B

SGGG
 .........570.........580.........590.........
Sequence FLQWVKEQKQFLVNVEQMTCATPVEMNTSLVLDFNNSTC
Predicted secondary structure






















SS confidence






































Known secondary structure (DSSP) TGGGBTTGGG
BB
SSS
SS
BGGG

S
TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D