Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2z63A_

Fold library idPDB HeaderMoleculeTitle
c2z63A_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 4, variable lymphocyte receptor b;PDBTitle: crystal structure of the tv8 hybrid of human tlr4 and hagfish vlrb.61


Added to library: Tue Mar 16 13:34:22 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

STTT

SS

SS

SSS
SS



S




TTTTTT
SS


TT




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFK
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) TTTT
TT


TT




TTTTTT
TT


TTS



STT
S
TT
TT



SS





 .........150.........160.........170.........180.........190.........200.........210
Sequence LPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

GGGGG
TT


TTS



GGGGT
TT



TT




TTTTTT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNC
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S
TTTTTT




SS


TTTTGGGGGSTTS
STTTTGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence LTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLE
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) GTT
SS

S

B

S



SS
B
SS

B
B
SS

S
BS

B



B
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence FLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SS

BT
S




S
ST
TT


TTSS
TTS
TTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence RNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAF
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TT


TTS



TTTTTT
TT


TT
GGG
S

TT
TT


TTS



TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence NSLSSLQVLNMASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT
TT



SS

S


TTTTTT
TT



SS
B


TTTTTGGGS

BBTTT
 .........570
Sequence GKPVRSIICP
Predicted secondary structure







SS confidence









Known secondary structure (DSSP)

BGGG




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D