Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2z62A_

Fold library idPDB HeaderMoleculeTitle
c2z62A_PDB header: immune systemChain: A: PDB Molecule: toll-like receptor 4, variable lymphocyte receptor b;PDBTitle: crystal structure of the tv3 hybrid of human tlr4 and hagfish vlrb.61


Added to library: Tue Mar 16 11:55:00 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

STTT
TTS

SS

SSS
TT


TT




TTTTTT
TT
S
TT




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFK
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTT
TT


TT




TTTTTT
TT


TTS



STT


TT
TT



SS





 .........150.........160.........170.........180.........190.........200.........210
Sequence LPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

GGGGG
TT



SS



GGGGT
TT



SS



TTSS
S



SS
 .........220.........230.........240.........250.........260.........270......
Sequence QLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Predicted secondary structure









































SS confidence

































































Known secondary structure (DSSP)

S


TTTTTT

S



SS
B


TTTTTGGGB
S

BBTTT

BGGG




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D