Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ymbC_

Fold library idPDB HeaderMoleculeTitle
c2ymbC_PDB header: protein transportChain: C: PDB Molecule: mit domain-containing protein 1;PDBTitle: structures of mitd1


Added to library: Thu Jan 10 14:49:10 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TTTT
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence DQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLPCKVKTIH
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTTTT




TTB



SSTT

TT


S


S







 .........150.........160.........170.........180.........190.........200.........210
Sequence LLTSLDEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



TTT

TT



TTS
SSTT

B


SSTT
TTS
 .........220.........
Sequence CDFDLRPCHETTVDIFHKK
Predicted secondary structure









SS confidence


















Known secondary structure (DSSP) S
TTSS
B
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D