Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ygdV_

Fold library idPDB HeaderMoleculeTitle
c2ygdV_PDB header: chaperoneChain: V: PDB Molecule:PDBTitle: molecular architectures of the 24meric eye lens chaperone2 alphab-crystallin elucidated by a triple hybrid approach


Added to library: Wed Jan 9 15:45:49 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRL
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)





GGGSSSS
SSTTS
SS
TTTT


BTTB






STTT
GGGTTSSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)




SS
GGGTTTT
TTT

SSS
TT
 .........150.........160.........170.....
Sequence GVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Predicted secondary structure






















SS confidence


































Known secondary structure (DSSP) T





SSS




SS

SSTT
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D