Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2y5qA_

Fold library idPDB HeaderMoleculeTitle
c2y5qA_PDB header: protein bindingChain: A: PDB Molecule: internalin b;PDBTitle: listeria monocytogenes inlb (internalin b) residues 36-392


Added to library: Sat Feb 26 09:27:34 2011
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LGSETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTK
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TTSS

S
S
STT
S
TTS
T


TTS

S

TTGGG
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLG
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)
TTS




GGGTT
TT


TTS



GGGGGG
TT


TTS




GGGGG
TT
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence NNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQEC
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) SS




GGGGG
TT
S

SS

S

GGGTT
TT



SS


B
GGGTT
TT
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence LNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFH
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)





SS



B
TTS
B

SSS
TT


SSS
STT
 .........
Sequence GRVTQPLKE
Predicted secondary structure



SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D