Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2xaiD_

Fold library idPDB HeaderMoleculeTitle
c2xaiD_PDB header: transcriptionChain: D: PDB Molecule: ankyrin repeat and socs box protein 9;PDBTitle: crystal structure of ankyrin repeat and socs box-containing2 protein 9 (asb9) in complex with elonginb and elonginc


Added to library: Sat Aug 28 21:52:07 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


T
TT

SS


TT


T
TT

TT


TTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLAC
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
TT

SS
S
TT

TT
TT

TT

BTTTB
 .........150.........160.........170.........180.........190.........200.........210
Sequence ENQQRACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVPPESPL
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) TT
T

TT

BTTB
T
TT

TT


TTS

GGGGS
TT
 .........220.........230.........240.........250.........
Sequence AQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL
Predicted secondary structure



















SS confidence
















































Known secondary structure (DSSP) GGG
S


TS
TT
GGGGGGSSS
T


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D