Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2wryA_

Fold library idPDB HeaderMoleculeTitle
c2wryA_PDB header: immune systemChain: A: PDB Molecule: interleukin-1beta;PDBTitle: crystal structure of chicken cytokine interleukin 1 beta


Added to library: Thu Oct 7 14:38:15 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIALYRPRAGTGQMPVALGIKGYKLY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTS
TT


SS



B





S
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPTEGTTRFESAAFPGWFICTSLQPRQPVGITN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT



S
STTGGGG
TTTTSSSTT
B
SSSS
S
 .........150....
Sequence QPDQVNIATYKLSG
Predicted secondary structure







SS confidence













Known secondary structure (DSSP) STTSSSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D