Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2wltA_

Fold library idPDB HeaderMoleculeTitle
c2wltA_PDB header: hydrolaseChain: A: PDB Molecule: l-asparaginase;PDBTitle: the crystal structure of helicobacter pylori l-asparaginase2 at 1.4 a resolution


Added to library: Sat Aug 28 15:52:05 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LPTIALLATGGTIAGSGASLGSYKSGELGVKELLKAIPSLNKIARIQGEQVSNIGSQDMNEEIWFKLAQR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

SGGG
B

TTS

BTT
S
TTT

SGGGT

GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence AQELLDDSRIQGVVITHGTDTLEESAYFLNLVLHSTKPVVLVGAMRNASSLSADGALNLYEAVSVAVNEK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TSTT



SSS


SS


SS
TTSTT
S
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SANKGVLVVMDDTIFSVREVVKTHTTHVSTFKALNSGAIGSVYYGKTRYYMQPLRKHTTESEFSLSQLKT
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) GTTS
STTTTT

SSS
TT

TTT

STT




S

GGG
S

GGG

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence PLPKVDIIYTHAGMTPDLFQASLNSHAKGVVIAGVGNGNVSAGFLKAMQEASQMGVVIVRSSRVGSGGVT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S




TT

TTT
SBTTTB

TT
SSSSS


 .........290.........300.........310.........320.......
Sequence SGEIDDKAYGFITSDNLNPQKARVLLQLALTKTNDKAKIQEMFEEYD
Predicted secondary structure












SS confidence














































Known secondary structure (DSSP) SSSS
T

TT







Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D