Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2wfhB_

Fold library idPDB HeaderMoleculeTitle
c2wfhB_PDB header: splicingChain: B: PDB Molecule: slit homolog 2 protein c-product;PDBTitle: the human slit 2 dimerization domain d4


Added to library: Sat Aug 28 16:10:51 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQS
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)

TT
TT
TTS

SS

TT

TT


TTS

SS

GGGGG
TT



SS





TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCN
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TTT
TT



SS





TTTTTT
TT



SS





TTTTTT
TT



SS

SGG
 .........150.........160.........170.........180.
Sequence MQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTC
Predicted secondary structure

















SS confidence








































Known secondary structure (DSSP) GTTTT
S
S

BSGGGTT
BTTTS
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D