Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2w8aC_

Fold library idPDB HeaderMoleculeTitle
c2w8aC_PDB header: membrane proteinChain: C: PDB Molecule: glycine betaine transporter betp;PDBTitle: crystal structure of the sodium-coupled glycine betaine2 symporter betp from corynebacterium glutamicum with bound3 substrate


Added to library: Tue Mar 16 14:09:03 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLNWSVIVPALVIVLATVVWGIGFKDSFTNFASSALSAVVDNLGWAFILFGTVFVFFIVVIAASKFGTIR
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)


SSSTTTSGGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence LGRIDEAPEFRTVSWISXXFAAGXGIGLXFYGTTEPLTFYRNGVPGHDEHNVGVAXSTTXFHWTLHPWAI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSSTT


SS


T

TTS
SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YAIVGLAIAYSTFRVGRKQLLSSAFVPLIGEKGAEGWLGKLIDILAIIATVFGTACSLGLGALQIGAGLS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTS


SSGGGGGTTTS
TTT

SSSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence AANIIESDWTIVGIVSVLTLAFIFSAISGVGKGIQYLSNANXVLAALLAIFVFVVGPTVSILNLLPGSIG
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTS




TTGGGTTS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NYLSNFFQXAGRTAXSADGTAGEWLGSWTIFYWAWWISWSPFVGXFLARISRGRSIREFILGVLLVPAGV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

TTTTSS
TTTTTTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence STVWFSIFGGTAIVFEQNGESIWGDGAAEEQLFGLLHALPGGQIXGIIAXILLGTFFITSADSASTVXGT
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) T




TT
STSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence XSQHGQLEANKWVTAAWGVATAAIGLTLLLSGGDNALSNLQNVTIVAATPFLFVVIGLXFALVKDLSNDV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTT
SS

GGGT
 .........500.........510
Sequence IYLEYREQQRFNARLARERR
Predicted secondary structure

SS confidence



















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D