Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2w3rG_

Fold library idPDB HeaderMoleculeTitle
c2w3rG_PDB header: oxidoreductaseChain: G: PDB Molecule: xanthine dehydrogenase;PDBTitle: crystal structure of xanthine dehydrogenase (desulfo form)2 from rhodobacter capsulatus in complex with hypoxanthine


Added to library: Tue Mar 16 12:31:31 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TT
S
TT
BT
TTS

S
SSSSS
TTTTTTT
BGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTS
GGGTS
TTS


TT

SS
TTTT


STT


SSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTS


GGGG

-

B

SS
TT
SS
TTTS




S
 .........220.........230.........240.........250.........260.........270.........280
Sequence AFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT
TTTS
TTTT
BTTT
TTSSS
TT
BTT
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDIS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) STT
TTGGGGTTS

TT
S

TT
SSSSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence AVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) STTSSSSS

TTTT
B

GGG




BTTB
 .........430.........440.........450
Sequence AYRMNAAQAMALRYVRELSGEAVAVLEVMP
Predicted secondary structure




SS confidence





























Known secondary structure (DSSP) TT



STT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D