Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2v9sC_

Fold library idPDB HeaderMoleculeTitle
c2v9sC_PDB header: structural proteinChain: C: PDB Molecule: slit homolog 2 protein n-product;PDBTitle: second lrr domain of human slit2


Added to library: Tue Mar 16 14:04:31 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAP
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)


TTSTT
TTS


S


S

TT



SS



TTSSTT
TT


TTS



T
 .........80.........90.........100.........110.........120.........130.........140
Sequence DAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINLRVDAFQDLHNLNLLSLYDNKLQTIA
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTTT
TT



SS





TTTTTT
TT



SS




GGGGTT
TT



SS

S


 .........150.........160.........170.........180.........190.........200......
Sequence KGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Predicted secondary structure









































SS confidence

































































Known secondary structure (DSSP) TTSSTT
TT



SS

SGGGS


SS

BSGGGTTSBGGGS
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D