Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2uzyA_

Fold library idPDB HeaderMoleculeTitle
c2uzyA_PDB header: signaling protein/receptorChain: A: PDB Molecule: internalin b;PDBTitle: structure of the human receptor tyrosine kinase met in2 complex with the listeria monocytogenes invasion protein3 inlb: low resolution, crystal form ii


Added to library: Tue Mar 16 14:14:20 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence METITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLF
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)




S
S
STT
S
TTS
T


TTS




TTGGG
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

SS




SGGGG
TT


TTS



GGGGTT
TT


TTS




GGGGG
TT
S

SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLN
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)




GGGGG
TT
S


SS




GGGGG
TT


TTS




GGGGG
TT




B

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence KPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGR
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

B


S




TTS




S
SSTT
SS

STT
 ......
Sequence VTQPLK
Predicted secondary structure



SS confidence





Known secondary structure (DSSP) B


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D