Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ru1A_

Fold library idPDB HeaderMoleculeTitle
c2ru1A_PDB header: hormoneChain: A: PDB Molecule: uncharacterized protein;PDBTitle: solution structure of esf3


Added to library: Sat Apr 26 08:15:31 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPEKMEVKEIGRSSKIILPACMHETCSGGFSLKNDCWCCLRLKTKQARCWKEKEFPNAKELCFANCPPLE
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)







TT

S



SSS

B
SSS
B





SB
SSS
SB


TTT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D