Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2rqrA_

Fold library idPDB HeaderMoleculeTitle
c2rqrA_PDB header: protein bindingChain: A: PDB Molecule: engulfment and cell motility protein 1, linker, dedicatorPDBTitle: the solution structure of human dock2 sh3 domain - elmo1 peptide2 chimera complex


Added to library: Sat Oct 30 10:28:49 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSSGSSGRLLDLENIQIPDAPPPIPKEPSNYDFSGPSSGIEGRGSSGSSGSSGSSGDKERHGVAIYNFQG
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)









SS





SS







SS



SS


TTTT








S
S



B
S
B

 .........80.........90.........100.........110.........
Sequence SGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT
Predicted secondary structure





















SS confidence
















































Known secondary structure (DSSP)
STTB

B
TT
TTSS
TT
GGGB






Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D