Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2ra8A_

Fold library idPDB HeaderMoleculeTitle
c2ra8A_PDB header: structural genomics, unknown functionChain: A: PDB Molecule: uncharacterized protein q64v53_bacfr;PDBTitle: crystal structure of the q64v53_bacfr protein from2 bacteroides fragilis. northeast structural genomics3 consortium target bfr43


Added to library: Tue Mar 16 14:21:45 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKRVFVFQDFKSQKFWSIDVRGTDVIVNYGKLGTDGQTQVKNFSSAGEAEKAAGKLIAEKTKKGYVETLE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SSS
TTTTS


SSTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence EVAKEXKVEAKKYALSYDEAEEGVNLXDKILKDKKLPSLKQITIGWGYEGEDCSDIADGIVENKEKFAHF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)






TT


TTGGG
S


SSS

STTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence EGLFWGDIDFEEQEISWIEQVDLSPVLDAXPLLNNLKIKGTNNLSIGKKPRPNLKSLEIISGGLPDSVVE
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) S



TTT

GGG
B

B
T
TT



BT
B

S
B
TT
S
SB

 .........220.........230.........240.........250.........260.........270.........280
Sequence DILGSDLPNLEKLVLYVGVEDYGFDGDXNVFRPLFSKDRFPNLKWLGIVDAEEQNVVVEXFLESDILPQL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SB
TT


B
GGGT

S
GGGTGGGS
TTT
TT

S
TT
SSGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence ETXDISAGVLTDEGARLLLDHVDKIKHLKFINXKYNYLSDEXKKELQKSLPXKIDVSDSQEYPXITELEH
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

SS

BTTTT
S

SBB



S

SB






GGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D