Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2qqhA_

Fold library idPDB HeaderMoleculeTitle
c2qqhA_PDB header: immune system, membrane proteinChain: A: PDB Molecule: complement component c8 alpha chain;PDBTitle: structure of c8a-macpf reveals mechanism of membrane attack2 in complement immune defense


Added to library: Tue Mar 16 12:37:03 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELDDEKYFRKPYNFL
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)
B

TTS
SSSS
B
TTT
TTT


B
TT

TTS
B
TTTT



SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYN
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



S

S
S
GGGS
SSS



TT


TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEY
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SS


SSS

B
TS
SS


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ILVIDKAKMESLXXXXXXXXXXXXRKAMAVEDIISRVRGGSSGYRSWGRSLKYNPVVIDFEMQPIHEVLR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)





STT



S





GGGS
GGGGGT
 .........290.........300....
Sequence HTSLGPLEAKRQNLRRALDQYLMA
Predicted secondary structure








SS confidence























Known secondary structure (DSSP) SSS
SGGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D