Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2qp2A_

Fold library idPDB HeaderMoleculeTitle
c2qp2A_PDB header: unknown functionChain: A: PDB Molecule: unknown protein;PDBTitle: structure of a macpf/perforin-like protein


Added to library: Tue Mar 16 12:18:02 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KSLEQENSERDVEIRDRNYFRKLSLFDDTVIAGAEMIGTSYDVFGKYCNVGSCMNSLFDERKINASEDNF
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
T

TTB
TTGGGTT
TTSSSS
GGG
B
T
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKVTILGKTLKVPYYIDCYSVGDLKYTNASGESIESYQSNISSKSRIKGNYLFFSASLKVDFDTDSLTDF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTT
SSTT

SSS

TTTTS
TGGGG
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence ENAFSRIQYTYDLYILKSSAEALKEFLKESVKTALDKADTEEDMNDLFNTWGSHFLSGVVMGGCAQYSSS
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) T

GGGB


ST
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence TNKYTSNLTNSFDVVAAASFAGFIGLSARTGNSFMEDIKKFRSASNIKTHAIGGDLSRFDPFGGATSADQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTS

SS
TT




TTTTSS
TTT

TTTT



SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PSAEEIAAAKKAFEDWKASVPNAPELVNFADSNPLTGIWELCSDRTQKAKLKKHFETVWAPAESAKRRVH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

STTS

SS

GGGG
S
TTT


 .........360.........370.........380.........390.........400.........410.........420
Sequence ADYIDEIIIGINNTNTPPEGYIGLKSTKDENLNSKGNICLFMHKAKYDPNIDNKDCITELKFITVRDKSP
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


TT



TT

BSSSB

SBTGGG


TTS




STT


 .........430.........440.........450.........460.........470.........480.........490
Sequence EGDWVKIPQDIYISPNQYLYLCYLPAKYSAEKAIKDIQLLCSSMILPYGYNDVLDERGERANATEDDNVH
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) STT

SS
S

STT


S

TTTS




S

TT

B
TTS
B




SSS
 ........
Sequence YLIYSAGW
Predicted secondary structure


SS confidence







Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D