Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2qm6C_

Fold library idPDB HeaderMoleculeTitle
c2qm6C_PDB header: transferaseChain: C: PDB Molecule: gamma-glutamyltranspeptidase;PDBTitle: crystal structure of helicobacter pylori gamma-2 glutamyltranspeptidase in complex with glutamate


Added to library: Tue Mar 16 12:00:54 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVALD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SSS




SSTT


TTT

SSS

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FREKAPLKATKNMFLDKQGNVVPKLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

B

TT

TTTTB
TTS
B
TTTTTSSGGG

B



S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISQRQAETLKEARERFLKYSSSKKYFFKKGHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

TTT
SBGGGB


TT


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALGYGASKN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT








TT

TT
STS
GGGT
TT
 .........290.........300.........310.........320.........330.........340........
Sequence IHIAAEAMRQAYADRSVYMGDADFVSVPVDKLINKAYAKKIFDTIQPDTVTPSSQIKPGMGQLHEGSN
Predicted secondary structure






























SS confidence



































































Known secondary structure (DSSP)
S
TTTS





TT



GGG

TTTT
S

TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D