Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2pr7A_

Fold library idPDB HeaderMoleculeTitle
c2pr7A_PDB header: hydrolaseChain: A: PDB Molecule: haloacid dehalogenase/epoxide hydrolase family;PDBTitle: crystal structure of uncharacterized protein (np_599989.1)2 from corynebacterium glutamicum atcc 13032 kitasato at3 1.44 a resolution


Added to library: Tue Mar 16 13:51:38 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GXRGLIVDYAGVLDGTDEDQRRWRNLLAAAKKNGVGTVILSNDPGGLGAAPIRELETNGVVDKVLLSGEL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



STTTTSS
TT

S

GGGGTTSSS
 .........80.........90.........100.........110.........120.........130.......
Sequence GVEKPEEAAFQAAADAIDLPXRDCVLVDDSILNVRGAVEAGLVGVYYQQFDRAVVEIVGLFGLEGEF
Predicted secondary structure



































SS confidence


































































Known secondary structure (DSSP) S

TTSTT

GGGS
T

S
T

S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D