Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2p4nB_

Fold library idPDB HeaderMoleculeTitle
c2p4nB_PDB header: transport proteinChain: B: PDB Molecule: tubulin beta chain;PDBTitle: human monomeric kinesin (1bg2) and bovine tubulin (1jff)2 docked into the 9-angstrom cryo-em map of nucleotide-free3 kinesin complexed to the microtubule


Added to library: Tue Mar 16 12:09:39 2010
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

B
TTTTTB
SS

B

SSSSSSTTGGGG

BSSSS
B


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence TMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSSSGGGSS
GGG

S


S
TT




STSSS



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDIC
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SSS



SSS
SSSSTTTS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence FRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TSS

SS

TS

TB



SSTT


S



STTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence RALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SSTSSTT
SSSS
GGGS
S


T
SSS
SSSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
STT
S

GGGTTTGGGTTT

 ......
Sequence YQQYQD
Predicted secondary structure

SS confidence





Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D